DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt3 and wntD

DIOPT Version :9

Sequence 1:XP_017452517.1 Gene:Wnt3 / 24882 RGDID:3972 Length:367 Species:Rattus norvegicus
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:261 Identity:70/261 - (26%)
Similarity:108/261 - (41%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Rat   122 RESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFAD 186
            ||..:|.||:.|.:...:|:.||.|  .|.||               ||:|:| ..|..:.|...
  Fly    81 REDVYVAAISMAAIVHTLTKDCANG--VIAGC---------------GCTENA-LNVPCAHEPTK 127

  Rat   187 ARENRP---DARSAMNKHNNEAGRTTILDHMHLKCKCH---GLSGSCEVKTCWWAQPDFRAIGDF 245
            |.|...   .:.|....||.......:...:..:|:|.   .:.|.|:.:.|......|.||...
  Fly   128 ALEQYEKHFGSGSGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQD 192

  Rat   246 LKDKYDSASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSF-GTRD 309
            |...||.|.::        .|....|:..:.  ..|.: .||:.::|||:|| ...||.: |||.
  Fly   193 LLQMYDDAIQL--------EGASSNLKIMWQ--NIPLD-SLVFMQDSPNYCE-RDATGLWKGTRG 245

  Rat   310 RTCNVTSHG-ID---GCDLLC--CG---RGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHT 365
            |.|:....| ::   .|..||  ||   |..:.|||:|   |:|...|...:.|..|:::...::
  Fly   246 RQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERR---CNCKLVWGFRLQCDVCVQLERQYS 307

  Rat   366 C 366
            |
  Fly   308 C 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt3XP_017452517.1 Wnt_Wnt3_Wnt3a <119..367 CDD:381709 70/261 (27%)
wntDNP_650272.1 wnt 41..308 CDD:302926 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.