DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt3 and Wnt10

DIOPT Version :9

Sequence 1:XP_017452517.1 Gene:Wnt3 / 24882 RGDID:3972 Length:367 Species:Rattus norvegicus
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:331 Identity:112/331 - (33%)
Similarity:147/331 - (44%) Gaps:95/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat   122 RESAFVHAIASAGVAFAVTRSCAEGTSTICGCD-------------------------------- 154
            |||||..||::||||.:|.|:|::|....||||                                
  Fly   143 RESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQI 207

  Rat   155 -------SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILD 212
                   .:.:......|||||||.:.||||..|:.|.|.||...|.:|.:|.|||.|||..:.:
  Fly   208 LTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSN 272

  Rat   213 HMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSA----------SEMVV----EKHRE 263
            :|..:|||||:||||::||||.:.|||..:|..||.::..|          .|.||    .::::
  Fly   273 NMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKK 337

  Rat   264 SRGW--------------------------VETLR----------------AKYALFKPPTERDL 286
            |.|.                          .||.|                ...|......|..|
  Fly   338 SNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSL 402

  Rat   287 VYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCY 351
            .||:.||||||.:......||..|.||..:...|||..|||||||:...::|.|:|||.|.|||.
  Fly   403 FYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCN 467

  Rat   352 VSCQEC 357
            |.|:||
  Fly   468 VECEEC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt3XP_017452517.1 Wnt_Wnt3_Wnt3a <119..367 CDD:381709 112/331 (34%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 106/322 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.