DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt3 and Wnt5

DIOPT Version :9

Sequence 1:XP_017452517.1 Gene:Wnt3 / 24882 RGDID:3972 Length:367 Species:Rattus norvegicus
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:507 Identity:124/507 - (24%)
Similarity:171/507 - (33%) Gaps:223/507 - (43%)


- Green bases have known domain annotations that are detailed below.


  Rat    63 GQGVANLALQGAFRSHHR------PLYLSIVALN----------------------SVCPSTKRI 99
            |.|.||        |||.      ..|...:.||                      ||.|:..| 
  Fly   519 GAGSAN--------SHHNDTTPTADAYSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISR- 574

  Rat   100 ILRSGLLRA-----------------TGGSLALHPMT--ATRESAFVHAIASAGVAFAVTRSCAE 145
                |...|                 |.......|||  |..|.||:||:|:|.|...:.|:|.:
  Fly   575 ----GARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRD 635

  Rat   146 GTSTICGCDSHHKGPP--GEGWKWGGCSEDADFGVLVSREFADARENRPD--------------- 193
            |....|.| |....|.  .:.||||||.::.:|....:.:|.|:||...:               
  Fly   636 GQLASCSC-SRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINK 699

  Rat   194 ----------------------------------------------------------------- 193
                                                                             
  Fly   700 NRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEI 764

  Rat   194 ----------------------------------------------------------------- 193
                                                                             
  Fly   765 LTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGIL 829

  Rat   194 --------ARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKY 250
                    |||.||.|||||||..::....:.|||||:||||.:.|||......|.|||:|::||
  Fly   830 PRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKY 894

  Rat   251 DSASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVT 315
            :.|:::.:.|    ||   .|:.|...||.||..||:|.:.||::|..:......||..|.|:..
  Fly   895 EGATKVKINK----RG---RLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKN 952

  Rat   316 SHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHTCK 367
            |.|::.|.:||||||:||:.....|:|:|.|||||.|.|:.|.::.:.||||
  Fly   953 SSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt3XP_017452517.1 Wnt_Wnt3_Wnt3a <119..367 CDD:381709 103/404 (25%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 112/462 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X108
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.