DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vhl and Vhl

DIOPT Version :9

Sequence 1:NP_434688.1 Gene:Vhl / 24874 RGDID:3960 Length:185 Species:Rattus norvegicus
Sequence 2:NP_001260885.1 Gene:Vhl / 53433 FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster


Alignment Length:138 Identity:35/138 - (25%)
Similarity:58/138 - (42%) Gaps:30/138 - (21%)


- Green bases have known domain annotations that are detailed below.


  Rat    33 NSREPSQ------------VIFCNRSPRVVLPLWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLF 85
            |:|:..|            |:|.|.:.|.:...|:........|.||.|....|::::..|.|||
  Fly     8 NNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLF 72

  Rat    86 RDAGTHDGLLVNQTELFVP--------------SLNVDGQPIFANITLPVYTLKERCLQVV-RSL 135
            ||..|.:.:.|....:|.|              .::|..:.:   |..|:.:|:|.||.:| |.|
  Fly    73 RDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVL---IHFPMRSLRENCLWLVARWL 134

  Rat   136 VKPENYRR 143
            ::..|..|
  Fly   135 IRTSNAPR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhlNP_434688.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
VHL 27..171 CDD:280091 35/138 (25%)
Interaction with Elongin BC complex. /evidence=ECO:0000250 123..132 4/8 (50%)
VhlNP_001260885.1 pVHL 21..162 CDD:176472 29/113 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4710
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509532at2759
OrthoFinder 1 1.000 - - FOG0005700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107013
Panther 1 1.100 - - LDO PTHR15160
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.