DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FRZB and smo

DIOPT Version :9

Sequence 1:NP_001454.2 Gene:FRZB / 2487 HGNCID:3959 Length:325 Species:Homo sapiens
Sequence 2:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster


Alignment Length:175 Identity:40/175 - (22%)
Similarity:60/175 - (34%) Gaps:41/175 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    31 RAAACEPV--RIPLC--KSLPWNMTKMP-NHLHHSTQANAIL----AIEQFEGLLGTHCSPDLLF 86
            |.|.|.|.  ....|  ..||:.::.:. ...|...:.|..|    |::..     ..|...:..
  Fly    86 RRARCYPTSNATNTCFGSKLPYELSSLDLTDFHTEKELNDKLNDYYALKHV-----PKCWAAIQP 145

Human    87 FLCAMYAPIC-TIDFQHEPIKPCKSVCERARQGCEPILIKYRHS-WPENLACEE----------- 138
            ||||::.|.| .|:.:.....|...:|   |...||..|.|..: :|:.|.|.|           
  Fly   146 FLCAVFKPKCEKINGEDMVYLPSYEMC---RITMEPCRILYNTTFFPKFLRCNETLFPTKCTNGA 207

Human   139 --LPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCK 181
              :.....|.|:||..         |.|:|.....|......:||
  Fly   208 RGMKFNGTGQCLSPLV---------PTDTSASYYPGIEGCGVRCK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FRZBNP_001454.2 CRD_SFRP3 32..157 CDD:143550 33/148 (22%)
NTR_Sfrp3_like 188..297 CDD:239636
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..325
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 32/142 (23%)
Frizzled 246..568 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.