DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgc and cathD

DIOPT Version :9

Sequence 1:NP_579818.1 Gene:Pgc / 24864 RGDID:3943 Length:392 Species:Rattus norvegicus
Sequence 2:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster


Alignment Length:403 Identity:168/403 - (41%)
Similarity:227/403 - (56%) Gaps:36/403 - (8%)


- Green bases have known domain annotations that are detailed below.


  Rat     6 VALLCLPLLEAS-----------LLRVPLRKMKSIRETMKEQGVLKDFLKTHKYDPGQKYHFGNF 59
            ||||.:..|.|:           ||||||.|.:|.|....:.|.....|:. :|..|.       
  Fly     4 VALLLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTELQQLRI-RYGGGD------- 60

  Rat    60 GDYSVLYEPMA-YMDASYFGEISIGTPPQNFLVLFDTGSSNLWVSSVYCQ--SEACTTHARFNPS 121
                 :.||:: ||||.|:|.|:||:|||||.|:||||||||||.|..|.  :.||..|.:::.|
  Fly    61 -----VPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDAS 120

  Rat   122 KSSTYYTEGQTFSLQYGTGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLA 186
            ||.||...|..|::|||:|||:|:...||:::..:.:.:|.|..:.:|||..||.|:||||:||.
  Fly   121 KSKTYTKNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLG 185

  Rat   187 YPGLSSGGATTALQGMLGEGALSQPLFGVYLGSQQGS-NGGQIVFGGVDKNLYTGEITWVPVTQE 250
            |..:|..........|..:|.:|.|:|..||.....| .||:|:|||.|.|.||||.|::|||::
  Fly   186 YNSISVDKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRK 250

  Rat   251 LYWQITIDDFLIGDQASGWCSSQGCQGIVDTGTSLLVMPAQYLSELLQTIGAQEGEYGEYFVSCD 315
            .||||.:|...|||..  .|.. |||.|.||||||:..|.:..:.:.|.||......|:|.||||
  Fly   251 AYWQIKMDAASIGDLQ--LCKG-GCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCD 312

  Rat   316 SVSSLPTLSFVLNGVQFPLSPSSYIIQ----EDNFCMVGLESISLTSESGQPLWILGDVFLRSYY 376
            .:..||.:.|||.|..|.|....||::    ....|:.|...:.:...:| |||||||||:..||
  Fly   313 LIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNG-PLWILGDVFIGKYY 376

  Rat   377 AIFDMGNNKVGLA 389
            ..|||||::||.|
  Fly   377 TEFDMGNDRVGFA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PgcNP_579818.1 A1_Propeptide 18..46 CDD:400357 11/27 (41%)
pepsin_retropepsin_like 73..391 CDD:416259 145/324 (45%)
cathDNP_001334713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.