DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp1 and CG18327

DIOPT Version :9

Sequence 1:NP_036814.1 Gene:Ucp1 / 24860 RGDID:3931 Length:307 Species:Rattus norvegicus
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:296 Identity:77/296 - (26%)
Similarity:134/296 - (45%) Gaps:16/296 - (5%)


- Green bases have known domain annotations that are detailed below.


  Rat    21 GVSACLADIITFPLDTAKVRLQIQGE--GQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQ 83
            ||:|..|.:.|.|::..|.|:|:|||  .:.|....||.|.....|:||.:|:..|..||...:.
  Fly    10 GVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAPALC 74

  Rat    84 RQISFASLRIGLY-DTVQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHL 147
            .|....|.|:.:| ..|::.:....:...|....:..|.:.|.|..:...|..::|.::|||:..
  Fly    75 FQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQAQAAK 139

  Rat   148 H---GIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNHHILA 209
            .   |.:.::....:|.|.|.....:..||:|:..|:.|..:.:..::..:...|..|..:.::.
  Fly   140 QIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKENGVVT 204

  Rat   210 DDVPCHLLSALVAGFCTTLLASPVDVVKTRFIN---SLPGQ---YPSVPSCAMTMYTKEGPAAFF 268
            ........|.|.||...:|..:|:|||.||..|   ...|:   |.....|.:|:...||....:
  Fly   205 HPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLY 269

  Rat   269 KGFAPSFLRLGSWNVIMFVCFEQLKKELMKSRQTVD 304
            |||.|.:||...::.::.:.|:    ||:..|:..|
  Fly   270 KGFWPIYLRSAPYSTLVLLFFD----ELIALREKYD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 28/84 (33%)
Solcar 1 11..102 28/83 (34%)
PTZ00169 21..297 CDD:240302 74/287 (26%)
Mito_carr 110..205 CDD:278578 20/97 (21%)
Solcar 2 111..201 19/92 (21%)
Solcar 3 210..295 25/90 (28%)
Mito_carr 215..300 CDD:278578 27/90 (30%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 26/76 (34%)
PTZ00169 5..293 CDD:240302 73/286 (26%)
Mito_carr 101..201 CDD:278578 20/99 (20%)
Mito_carr 204..296 CDD:278578 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.