DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and AKR1C3

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001240837.1 Gene:AKR1C3 / 8644 HGNCID:386 Length:323 Species:Homo sapiens


Alignment Length:305 Identity:62/305 - (20%)
Similarity:115/305 - (37%) Gaps:91/305 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VISTGNIIATELGQRKSNEELYDGLKITLHTDSTAERVVVE---KEIDELH--GRVQRATQELTT 72
            |:..|.....|:.:.|:       |::|        ::.:|   :.||..|  ...::....:.:
Human    18 VLGFGTYAPPEVPRSKA-------LEVT--------KLAIEAGFRHIDSAHLYNNEEQVGLAIRS 67

  Fly    73 RLTENG--RNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATT 135
            ::.:..  |.:|...:|::...|..|.|..|:|..|....:.:|| :.|.:.|.::.....::.|
Human    68 KIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVD-LYLIHSPMSLKPGEELSPT 131

  Fly   136 KPPCSEDSNVSRATNWSQRNGKE--GVAELKELYKTLEQYALKQQITQLGIADLDAAALEELHN- 197
                             ..|||.  .:.:|...::.:|:.........:|:::.:...||.:.| 
Human   132 -----------------DENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNK 179

  Fly   198 -SAQVVPTIAQV------NLSTCCVVPPELQEFCTAHDIQLNTHS-----------DPE--LLL- 241
             ..:..|...||      |.|       :|.:||.:.||.|..:|           ||.  :|| 
Human   180 PGLKYKPVCNQVECHPYFNRS-------KLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLE 237

  Fly   242 -PV--------EQFDGLVPGYTIDWTLRYQVHVRCRGVLT-AKGY 276
             ||        ::...|:       .||||:.   |||:. ||.|
Human   238 DPVLCALAKKHKRTPALI-------ALRYQLQ---RGVVVLAKSY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 36/179 (20%)
AKR1C3NP_001240837.1 ARA1 9..305 CDD:223729 62/305 (20%)
Tas 17..297 CDD:223739 62/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.