DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and YJR096W

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_012630.1 Gene:YJR096W / 853559 SGDID:S000003857 Length:282 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:44/277 - (15%)
Similarity:110/277 - (39%) Gaps:61/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIPTITK-----KYQNVVISTGNIIATELGQRKSNEELYDGLKITLHTDSTAERVVVEKEIDELH 60
            |:|...|     |..::.:.|     .::.:.::.|.:|:|:|.......||.....|||:.:  
Yeast     1 MVPKFYKLSNGFKIPSIALGT-----YDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGD-- 58

  Fly    61 GRVQRATQELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNA 125
            |.::...::    ...:.|.||....|::.:::..:....|:.:.|:.:|.....:::|.:.|  
Yeast    59 GIIKWLNED----PGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSP-- 117

  Fly   126 VATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQLGIADLDAA 190
                                           .||.....|.::.:::...:..:..:|:::....
Yeast   118 -------------------------------LEGSKLRLETWRAMQEAVDEGLVKSIGVSNYGKK 151

  Fly   191 ALEELHNSAQV--VPTIAQVNLSTCCVVPPELQEFCTAHDIQLNTH---------SDPELLLPVE 244
            .::||.|..::  .|.:.|:.:|. .::..||.::|.:..:.:...         ::|:||...:
Yeast   152 HIDELLNWPELKHKPVVNQIEISP-WIMRQELADYCKSKGLVVEAFAPLCHGYKMTNPDLLKVCK 215

  Fly   245 QFDGLVPGYTIDWTLRY 261
            :.|.......|.|:|::
Yeast   216 EVDRNPGQVLIRWSLQH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 22/169 (13%)
YJR096WNP_012630.1 AKR_AKR1-5-like 14..266 CDD:381297 40/264 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.