DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and ARA1

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_009707.3 Gene:ARA1 / 852446 SGDID:S000000353 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:73/304 - (24%)
Similarity:122/304 - (40%) Gaps:81/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VISTGNIIATELGQRKSNEELY----DGLKIT---LHTDSTAERVVVEKE------------ID- 57
            |.||.||:...|..:.:  |:|    :|::|.   |.|.:..|::...|:            || 
Yeast     5 VASTENIVENMLHPKTT--EIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDT 67

  Fly    58 ----ELHGRVQRATQELTTRLTENG---RNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVD 115
                |....|..|.:|    |.|:|   |.::.|..|::  ....:.|::::.|.|..|.:.:||
Yeast    68 AWAYETEPFVGEAIKE----LLEDGSIKREDLFITTKVW--PVLWDEVDRSLNESLKALGLEYVD 126

  Fly   116 NVVLAYH----------PNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKELYKTL 170
              :|..|          |..::     ...|.|..:......|.:          .:..|.||.|
Yeast   127 --LLLQHWPLCFEKIKDPKGIS-----GLVKTPVDDSGKTMYAAD----------GDYLETYKQL 174

  Fly   171 EQYAL---KQQITQLGIADLDAAALEELHNSAQVVPTIAQVNLSTCCVVPP-ELQEFCTAHDI-- 229
            |:..|   ..::..:|:::.....||.|....:|.||:.||  .|...:|. ||::||..|||  
Yeast   175 EKIYLDPNDHRVRAIGVSNFSIEYLERLIKECRVKPTVNQV--ETHPHLPQMELRKFCFMHDILL 237

  Fly   230 ----QLNTHSDPELLLPVEQFDGLVPGYTI---DWTLRYQVHVR 266
                .|.:|..|.|.:|:.:  .|...|.:   |..:.|  |:|
Yeast   238 TAYSPLGSHGAPNLKIPLVK--KLAEKYNVTGNDLLISY--HIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 41/178 (23%)
ARA1NP_009707.3 AKR_AKR3C1 22..321 CDD:381345 67/285 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.