DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and YDL124W

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_010159.1 Gene:YDL124W / 851433 SGDID:S000002282 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:56/250 - (22%)
Similarity:93/250 - (37%) Gaps:71/250 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QNVVISTGN------IIATELGQR-KSNEELYDGLKITLHTDSTAERVVVEKEIDELH------- 60
            |...::.||      ||.|  |.| ..|||          ||:|....:||:.:..|.       
Yeast     6 QFFTLNNGNKIPAIAIIGT--GTRWYKNEE----------TDATFSNSLVEQIVYALKLPGIIHI 58

  Fly    61 --GRVQRATQEL--TTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAY 121
              ..:.|...|:  ...|||..||.|.:..|.......::|....::..|..:...:|| :.|.:
Yeast    59 DAAEIYRTYPEVGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVD-LYLLH 122

  Fly   122 HPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQLGIAD 186
            .|                    .||:..|        |:: |:|.:|.:||.....:...:|:::
Yeast   123 SP--------------------FVSKEVN--------GLS-LEEAWKDMEQLYKSGKAKNIGVSN 158

  Fly   187 LDAAALEELHNSAQVVPTIAQVNLSTCCVVP------PELQEFCTAHDIQLNTHS 235
            .....|:.:...|:|.|.:.|:..|     |      |.:.:||..|||.:..:|
Yeast   159 FAVEDLQRILKVAEVKPQVNQIEFS-----PFLQNQTPGIYKFCQEHDILVEAYS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 33/162 (20%)
YDL124WNP_010159.1 AKR_AKR3C2-3 13..291 CDD:381346 54/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.