DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and akr1a1b

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_005166342.1 Gene:akr1a1b / 799805 ZFINID:ZDB-GENE-050417-118 Length:351 Species:Danio rerio


Alignment Length:290 Identity:59/290 - (20%)
Similarity:105/290 - (36%) Gaps:73/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TKKYQNVVISTGNIIATELGQRKSNEELYDGLKITLHTDSTAERVVVEKEIDELHGRVQRATQEL 70
            |.|.:..::....|.|.|.|.|              |.| .|.....|.||.|       |.|| 
Zfish    47 TWKSEPGLVKQAVIWALESGYR--------------HID-CAPIYANEPEIGE-------AFQE- 88

  Fly    71 TTRLTENG--RNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATA-TPV 132
             |...:.|  |.::.:.:|::..:|..:.|..::.:.|..|.:.::| :.|.:.|.|.... ||.
Zfish    89 -TMGPDKGIRREDVFVTSKLWNTKHHPDDVEPSLLKTLKDLKLEYLD-LYLIHWPYAFQRGDTPF 151

  Fly   133 ATTKPPCSED-----SNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQLGIADLDAAAL 192
                 |..||     .::.....|:                .:|:...|..:..:|:::.::..:
Zfish   152 -----PRKEDGTLLYDDIDYKLTWA----------------AMEKLVGKGLVRAIGLSNFNSRQI 195

  Fly   193 EELHNSAQVVPTIAQVNLSTCCVVPPELQEFCTAHDIQLNT------------HSDPELLLPVEQ 245
            :::.:.|.:.||:.||. |...:...||...|....:.:..            |.|..:||....
Zfish   196 DDILSVASIKPTVLQVE-SHPYLAQVELLSHCRDRGLVMTAYSPLGSPDRAWKHPDEPVLLEEPA 259

  Fly   246 FDGLVPGYT---IDWTLRYQVHVRCRGVLT 272
            ...|...|.   ....:|:|..   |||:|
Zfish   260 IAALAKKYNKTPAQIIIRWQTQ---RGVVT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 30/176 (17%)
akr1a1bXP_005166342.1 ARA1 27..324 CDD:223729 59/290 (20%)
Tas 36..320 CDD:223739 59/290 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.