DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1c21

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_084177.2 Gene:Akr1c21 / 77337 MGIID:1924587 Length:323 Species:Mus musculus


Alignment Length:271 Identity:55/271 - (20%)
Similarity:97/271 - (35%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ITKKYQNVVISTGNII-----ATELGQRKSNEELYDGLKITL-----HTDSTAERVVVEKEIDEL 59
            :..|...|:::.||.|     .|.|.......:..:..||.:     |.||.:    |....|.:
Mouse     1 MNSKCHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSAS----VYNTEDHV 61

  Fly    60 HGRVQRATQELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPN 124
            ...::....:.|.|     |.:|...:|::......|.|..::|..|..|...:|| :.|.::|.
Mouse    62 GEAIRSKIADGTVR-----REDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVD-LYLIHYPM 120

  Fly   125 AVATATPVATTKP-----PCSED-----SNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQI 179
            |:         ||     |..|.     ..|.....|      |.:.:.|:...|          
Mouse   121 AL---------KPGEENFPVDEHGKLIFDRVDLCATW------EAMEKCKDAGLT---------- 160

  Fly   180 TQLGIADLDAAALEELHN--SAQVVPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTHSDPEL 239
            ..:|:::.:...||.:.|  ..:..|...||.    |   :...:|.:||.:.||.|..:.    
Mouse   161 KSIGVSNFNYRQLEMILNKPGLKYKPVCNQVE----CHPYLNQMKLLDFCKSKDIVLVAYG---- 217

  Fly   240 LLPVEQFDGLV 250
            :|..:::.|.|
Mouse   218 VLGTQRYGGWV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 36/173 (21%)
Akr1c21NP_084177.2 AKR_AKR1C1-35 6..308 CDD:381334 54/266 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.