DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1b10

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_765986.3 Gene:Akr1b10 / 67861 MGIID:1915111 Length:316 Species:Mus musculus


Alignment Length:206 Identity:40/206 - (19%)
Similarity:79/206 - (38%) Gaps:46/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EKEIDELHGRVQRATQELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNV 117
            |.|:.|   .:|...||...:     |.::.|.:|::........|.:|.:..|..|.:.::| :
Mouse    52 ESEVGE---AIQEKIQEKAVK-----REDLFIVSKLWSTFFEKSLVKKAFQNTLSDLKLDYLD-L 107

  Fly   118 VLAYHPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQL 182
            .|.:.|....:......|     :|.....::.::..:..|.:.||      ::|..:|    .|
Mouse   108 YLIHWPQGFQSGNVFLPT-----DDKGSILSSKYTFLDAWEAMEEL------VDQGLVK----AL 157

  Fly   183 GIADLDAAALEELHNSAQV--VPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTHS------- 235
            |:::.:...:|.|.|...:  .|...||.    |   :...:|.::|.:..|.:..:|       
Mouse   158 GVSNFNHFQIERLLNKPGLKHKPVTNQVE----CHPYLTQEKLIQYCHSKGITITAYSPLGSPDR 218

  Fly   236 ------DPELL 240
                  ||.||
Mouse   219 PSAKPEDPLLL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 31/176 (18%)
Akr1b10NP_765986.3 ARA1 1..297 CDD:223729 40/206 (19%)
Tas 9..289 CDD:223739 40/206 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.