Sequence 1: | NP_001262845.1 | Gene: | Gclm / 248194 | FlyBaseID: | FBgn0046114 | Length: | 285 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064695.3 | Gene: | AKR1B10 / 57016 | HGNCID: | 382 | Length: | 316 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 40/206 - (19%) |
---|---|---|---|
Similarity: | 78/206 - (37%) | Gaps: | 46/206 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 EKEIDELHGRVQRATQELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNV 117
Fly 118 VLAYHPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQL 182
Fly 183 GIADLDAAALEELHN--SAQVVPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTHS------- 235
Fly 236 ------DPELL 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gclm | NP_001262845.1 | Aldo_ket_red | <79..>238 | CDD:294321 | 31/176 (18%) |
AKR1B10 | NP_064695.3 | AKR_AKR1B1-19 | 10..316 | CDD:381333 | 40/206 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0656 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |