DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1e1

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_061347.2 Gene:Akr1e1 / 56043 MGIID:1914758 Length:301 Species:Mus musculus


Alignment Length:279 Identity:50/279 - (17%)
Similarity:101/279 - (36%) Gaps:75/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NIIATELGQRKSNE-ELYDGLKITL-------------HTDSTAERVVVEKEIDELHGRVQRATQ 68
            ||....||..|::. |:.|.:|:.:             |.:|.....:.|| |.|  |.|:    
Mouse     3 NIPTVGLGTWKASPGEVTDAVKLAINLGYRHFDCAYLYHNESEVGMGISEK-IKE--GVVK---- 60

  Fly    69 ELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVA 133
                      |.::.:.:|::...|....|..|....|..|::.::| :.|.:.|...       
Mouse    61 ----------REDLFVVSKLWCTCHKKSLVKTACTNTLEALNLDYLD-LYLIHWPMGF------- 107

  Fly   134 TTKPPCSEDSNVSRATNWSQRNGK--EGVAELKELYKTLEQYALKQQITQLGIADLDAAALEELH 196
               .|..:|..:       .||||  .......:.::.:|....:..:..||:::.:...||.|.
Mouse   108 ---KPGEKDIPL-------DRNGKVIPSHTSFLDTWEAMEDLVFEGLVKNLGVSNFNHEQLERLL 162

  Fly   197 N--SAQVVPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTH------------SDPELLLPVE 244
            :  ..:|.|...|:.    |   :...:|.:||...::.:..:            .|..::..:.
Mouse   163 DKPGLRVRPITNQIE----CHPYLNQKKLIDFCHKRNVSVTAYRPLGGSGGGFHLMDDTVIRKIA 223

  Fly   245 QFDGLVPGYTIDWTLRYQV 263
            :..|..|...:   :|:|:
Mouse   224 KKHGKSPAQIL---IRFQI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 30/177 (17%)
Akr1e1NP_061347.2 Tas 4..287 CDD:223739 49/278 (18%)
ARA1 4..282 CDD:223729 49/278 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.