DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and akr1b1.2

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001070715.1 Gene:akr1b1.2 / 553452 ZFINID:ZDB-GENE-041210-132 Length:316 Species:Danio rerio


Alignment Length:191 Identity:36/191 - (18%)
Similarity:70/191 - (36%) Gaps:60/191 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATAT---PVATTKPPCS 140
            |.|:.:.:|::...|....|..|.::.|..|::.::| :.|.:.|....:.:   |:.:......
Zfish    70 REELFVVSKLWCTFHEKALVKGACQKTLSDLNLDYLD-LYLIHWPMGFKSGSEQFPLDSEGLTIG 133

  Fly   141 EDSNVSRATNWSQRNGKEGVAELKE--LYKTLEQYALKQQITQLGIADLDAAALEEL-------- 195
            :||  |....|      ||:.||.:  |.|.            :||::.:...:|.:        
Zfish   134 DDS--SFLDTW------EGMEELVDAGLVKA------------IGISNFNREQIEAILNKPGLKY 178

  Fly   196 ---HNSAQVVPTIAQVNLSTCCVVPPELQEFCTAHDIQLNTHS-------------DPELL 240
               :|..:..|.:.|          .:|..:|.:..|.:..:|             ||.||
Zfish   179 KPANNQVECHPYLTQ----------DKLISYCQSKGITVTAYSPLGSPDRPWAKPEDPSLL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 33/187 (18%)
akr1b1.2NP_001070715.1 ARA1 1..306 CDD:223729 36/191 (19%)
Tas 8..289 CDD:223739 36/191 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.