DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and zgc:110366

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001278275.1 Gene:zgc:110366 / 550476 ZFINID:ZDB-GENE-050417-302 Length:291 Species:Danio rerio


Alignment Length:268 Identity:56/268 - (20%)
Similarity:98/268 - (36%) Gaps:70/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LYDGLKI------TLHTDSTAERVVVE-------KEID--ELHGRVQRATQELTTRLTENG--RN 80
            |::||.|      |.|....:...|:.       :.||  :.:|    ..:.|...:||:|  |.
Zfish    18 LHNGLNIPILGLGTSHYGGYSHEAVLYALQECGIRHIDTAKRYG----CEEALGKAVTESGVQRE 78

  Fly    81 EISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATTKPPCSEDSNV 145
            |:.|..|::...:..:|..||..:....|.|.::| :.|.:.|:::..           ...|..
Zfish    79 ELWITTKLWPGDYGYQSTKQACRDSCARLGVDYLD-LYLMHWPDSMVP-----------GRSSQE 131

  Fly   146 SRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQLGIADLDAAALEELHNSAQVVPTIAQVNL 210
            .|...|         ..|:|||.       :.....:|:::.....|.||.:...:||.:.||..
Zfish   132 VRLETW---------RALEELYD-------EGLCRAIGVSNFLIPHLNELKDCGGIVPHVNQVEF 180

  Fly   211 STCCVVPPELQEFCTAHDI-----------QLNTHSDPELLLPVEQFDGLVPGYTIDWTLRYQVH 264
            .. ...|.:|.|.|...:|           |..||  |.:|...:::........|.|:::    
Zfish   181 HP-FQQPMKLVEHCRKENIVFEGYCPLAKGQALTH--PHILELAKKYGRSASQICIRWSIQ---- 238

  Fly   265 VRCRGVLT 272
               .||:|
Zfish   239 ---NGVVT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 35/169 (21%)
zgc:110366NP_001278275.1 ARA1 16..277 CDD:223729 56/268 (21%)
Tas 19..276 CDD:223739 55/267 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.