DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and gclm

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001016536.1 Gene:gclm / 549290 XenbaseID:XB-GENE-1014945 Length:274 Species:Xenopus tropicalis


Alignment Length:293 Identity:94/293 - (32%)
Similarity:145/293 - (49%) Gaps:46/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TITKKYQNVVISTGNIIATELGQRK----SNEELYDGLKITLHTDSTAERVVVEKEIDE-LHGRV 63
            |:..|...:||.|||::.....::|    .:|||.|.::.||:..|......:.|||.: |...|
 Frog    10 TLLDKADKLVIQTGNLLNWGCLKKKCPSTPSEELQDCIRTTLNEWSQKFSPELVKEIPQTLECTV 74

  Fly    64 QRATQELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVAT 128
            .:|.:  |..|.|  |.|:.:..|:|:...|..||.||::.....|.|..:|::::|        
 Frog    75 PQAME--TINLDE--REEMKVSVKLFIVSPSHSSVTQAIDMACSTLGVAQIDSMIIA-------- 127

  Fly   129 ATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQLGIADLDAAALE 193
                    ||..||..     ::|..|       |:..::.||......::..:|.:|||.|.||
 Frog   128 --------PPPLEDGR-----SFSLEN-------LQPYWEELESLVRNGKVVSIGTSDLDKALLE 172

  Fly   194 ELHNSAQVVPTIAQVNLSTCCVVPPELQEFCTAHDIQLNTHSDPELLLPVEQFDGLV-------- 250
            :|:..:||.|...||||::||::||:|.||....||||.||:||:.||..|.|...:        
 Frog   173 QLYLWSQVKPASNQVNLASCCIMPPDLTEFAKQFDIQLLTHNDPKELLSEEAFQEALKESAQECH 237

  Fly   251 -PGYTIDWTLRYQVHVRCRGVLTAKGYIVGASR 282
             ..::..|.|||.|.|:.||::..||||:.|.|
 Frog   238 SSAWSPIWILRYSVIVKTRGIIKLKGYILQAQR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 51/158 (32%)
gclmNP_001016536.1 AKR_SF <86..255 CDD:382030 62/196 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1557
Inparanoid 1 1.050 102 1.000 Inparanoid score I4840
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1516283at2759
OrthoFinder 1 1.000 - - FOG0006260
OrthoInspector 1 1.000 - - oto104777
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4224
SonicParanoid 1 1.000 - - X5208
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.