DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and zgc:110782

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001013503.1 Gene:zgc:110782 / 541358 ZFINID:ZDB-GENE-050320-51 Length:287 Species:Danio rerio


Alignment Length:227 Identity:47/227 - (20%)
Similarity:90/227 - (39%) Gaps:56/227 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LHGRVQRATQELTTRLTENG--RNEISIGAKIFLNRH---STESVNQAVEELLHILSVTHVDNVV 118
            ::|......|.|...|.:.|  |.::.|.:|:..:.|   :.|...:::|:    |...::|..:
Zfish    50 VYGNEAHLGQVLKELLPKYGLIREDVFIISKLAPSDHGLRAKEGCLRSLEQ----LDCEYIDLYL 110

  Fly   119 LAYHPNAVATATPVATTKPPCSEDSNVS--RATNWSQRNGKEGVAELKELYKTLEQYALKQQITQ 181
            :  |...:....|         |||..|  ||.:|:                |||::....|...
Zfish   111 I--HWPGMEGLDP---------EDSRHSEYRAQSWA----------------TLEEFHASGQFKA 148

  Fly   182 LGIADLDAAALEELHNSAQVVPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTHS-------- 235
            :|:::..|..:.||..|.:|.|.:.|:.    |   ::..||::.|....|....:|        
Zfish   149 IGVSNYTAKHIRELLASCRVPPAVLQIE----CQPKLIQRELRDLCMETGIHFQAYSSLGKGALL 209

  Fly   236 -DPELLLPVEQFDGLVPGYT-IDWTLRYQVHV 265
             :|| ::.:.:..|..|... :.|.|:..:.|
Zfish   210 REPE-VMDIVRHCGRTPAQVLLRWALQQGISV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 35/175 (20%)
zgc:110782NP_001013503.1 ARA1 1..280 CDD:223729 47/227 (21%)
Tas 17..271 CDD:223739 47/227 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.