DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and zgc:101765

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001006056.1 Gene:zgc:101765 / 450036 ZFINID:ZDB-GENE-041010-156 Length:288 Species:Danio rerio


Alignment Length:216 Identity:39/216 - (18%)
Similarity:80/216 - (37%) Gaps:56/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RNEISIG--AKIFLNRH--STESV---------------NQAVEELLHILSVTHVDNVVLAYHPN 124
            |||..:|  .:..|.:|  |.|.|               ....::.|..|.:.::| :.|.:.|.
Zfish    54 RNEAHLGHALRCLLPKHGLSREDVFITSKLGPKDQGSKARNGCQKSLEQLGLGYID-LYLIHWPG 117

  Fly   125 AVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQLGIADLDA 189
              ....||...:.|      .:||.:|                :.||::..:.:...:|:::...
Zfish   118 --TQGLPVGDKRNP------ENRAQSW----------------RVLEEFYSEGKFRAIGVSNYTV 158

  Fly   190 AALEELHNSAQVVPTIAQVNLSTCCVVPPELQEFCTAHDIQLNTH---------SDPELLLPVEQ 245
            ..::||..|.:|.|.:.||.... .::..:|:..|....:....:         |:| ::|.:.:
Zfish   159 EHMQELLKSCKVPPAVLQVEFHP-KLLQNDLRGLCKIRGVCFQAYSSLGTGLLLSNP-VVLEIAK 221

  Fly   246 FDGLVPGYT-IDWTLRYQVHV 265
            ..|..|... :.|.::..:.|
Zfish   222 ECGRTPAQVLLRWAVQQSIAV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 33/186 (18%)
zgc:101765NP_001006056.1 ARA1 5..283 CDD:223729 39/216 (18%)
Tas 11..271 CDD:223739 39/216 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.