DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1B

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster


Alignment Length:290 Identity:57/290 - (19%)
Similarity:113/290 - (38%) Gaps:67/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKY---QNVVISTGN-IIATELGQRKSNE-ELYDGLKITL-----HTDSTAERVVVEKEIDELHG 61
            |:|   ..||...|| |....||...|.: ::.:.:|:.:     |.|..   .|.:.| ||:..
  Fly    32 KEYARAPKVVCLDGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCA---YVYQNE-DEVGD 92

  Fly    62 RVQRATQELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAV 126
            .|:...:|...:     |.::.|.:|::...|..:.|..|:|..|..|.:.::| :.|.:.|...
  Fly    93 GVEAKIKEGVVK-----REDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLD-LYLIHWPMGY 151

  Fly   127 ATATPVATTKPPCSEDSNVSRATNWSQRNGKE--GVAELKELYKTLEQYALKQQITQLGIADLDA 189
            .....:..|                 .::||.  ...:..:.:|.:|:...:..:..:|:::.:.
  Fly   152 KEGCDLFPT-----------------DKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNR 199

  Fly   190 AALEELHNSAQVVPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTHS-------------DPE 238
            ..:|.:...|.:.|...|:.    |   :...:|.:||.:.||.:..:|             ||.
  Fly   200 RQIERVLEVATIPPVTNQIE----CHPYLTQKKLIDFCKSKDITITAYSPLGSPNRPWAKAGDPV 260

  Fly   239 LL--LPVEQFDG---LVPGYTIDWTLRYQV 263
            :|  ..:::...   ..||..:   :||||
  Fly   261 ILEEAKIKEIAAKKKKTPGQIL---IRYQV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 30/176 (17%)
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 55/284 (19%)
Tas 45..>248 CDD:223739 44/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.