DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1c15

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:299 Identity:65/299 - (21%)
Similarity:116/299 - (38%) Gaps:79/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VISTGNIIATELGQRKSNEELYDGLKITLHTDSTAERVVVE---KEIDE--LHGRVQRATQELTT 72
            |:..|...:.|:.:.|:.|               |.:|.::   :.||.  .:...:...|.|..
  Rat    19 VLGFGTFASKEIPKSKAAE---------------ATKVAIDVGFRHIDAAYFYQNEEEVGQALRD 68

  Fly    73 RLTEN--GRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATT 135
            ::.:.  .|.::....||::.....|.|.|.:|..|..|.:.:||..::  |       .|:| .
  Rat    69 KMADGTVKREDLFYTTKIWITFLRPELVRQCLERSLKKLGLDYVDLCII--H-------IPIA-M 123

  Fly   136 KPPCSEDSNVSRATNWSQRNGK--EGVAELKELYKTLEQYALKQQITQLGIADLDAAALEELHNS 198
            ||  .|:.....|      |||  ....::::.::.||:.........:|:::.:...||.:.|.
  Rat   124 KP--GEELLPKDA------NGKFIFDTVDIRDTWEALEKCKDAGLSKSIGVSNFNHKQLELILNK 180

  Fly   199 AQV--VPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTHS--------------------DPE 238
            .::  .||..||.    |   :...:|.|||.:.||.|..:|                    || 
  Rat   181 PRLKYKPTCNQVE----CHPYLNQSKLLEFCKSKDIVLVAYSALGSHRDSSWVSSDSPYLLEDP- 240

  Fly   239 LLLPVEQFDGLVPGYTIDWTLRYQVHVRCRGVLT-AKGY 276
            :|:.:.:.....||..   .||||:.   |||:. ||.:
  Rat   241 VLMTIAKKHNQTPGQV---ALRYQLQ---RGVVVLAKSF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 41/185 (22%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 65/299 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.