DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1c13

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_006254252.1 Gene:Akr1c13 / 361266 RGDID:1308232 Length:371 Species:Rattus norvegicus


Alignment Length:198 Identity:41/198 - (20%)
Similarity:78/198 - (39%) Gaps:40/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 HTDSTAERVVVEKEIDE-LHGRVQRATQELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEEL 105
            |.| ||....:|:||.: :..:::....:         |.::.|..|::......|.|..|:|:.
  Rat    96 HID-TAYAYQIEEEIGQAIQSKIKAGVVK---------REDMFITTKLWCTCFRPELVKPALEKS 150

  Fly   106 LHILSVTHVDNVVLAYHPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKE--GVAELKELYK 168
            |..|.:.:.|..::.|         ||    |..|.|::..     ....||.  ...:..:.::
  Rat   151 LKNLQLDYADLYIMHY---------PV----PMKSGDNDFP-----VDEKGKSLLDTVDFCDTWE 197

  Fly   169 TLEQYALKQQITQLGIADLDAAALEELHN--SAQVVPTIAQVNLSTCC---VVPPELQEFCTAHD 228
            .||:......:..:|:::.:...||.|.|  ..:..|...||.    |   :...:|.::|.:.|
  Rat   198 MLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVE----CHLYLNQSKLLDYCKSKD 258

  Fly   229 IQL 231
            |.|
  Rat   259 IVL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 34/160 (21%)
Akr1c13XP_006254252.1 Tas 77..345 CDD:223739 41/198 (21%)
ARA1 89..353 CDD:223729 41/198 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.