DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and CG9436

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster


Alignment Length:222 Identity:46/222 - (20%)
Similarity:82/222 - (36%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIPTITKKYQNVVISTGNIIAT-ELGQRKSNE-ELYDGLKITL-----HTDSTAERVVVEKEIDE 58
            :.|||.       ::.|..:.| .||..||.| :.|...:..|     |.|:.   .|.|.|.: 
  Fly     4 LAPTIR-------LNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTA---FVYENEAE- 57

  Fly    59 LHGRVQRATQELTTRLTEN--GRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAY 121
                   ..|.::.::.|.  .|.|:.:..|:....|....|.:|....|..|.:.:|| :.|.:
  Fly    58 -------VGQAISEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVD-LYLMH 114

  Fly   122 HPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKEL-----YKTLEQYALKQQITQ 181
            .|           .......||||            .|..||.::     ::.:|:.........
  Fly   115 MP-----------VGQKFHNDSNV------------HGTLELTDVDYLDTWREMEKLVDLGLTRS 156

  Fly   182 LGIADLDAAALEELHNSAQVVPTIAQV 208
            :|:::.:||..|.:..:.::.|.:.||
  Fly   157 IGLSNFNAAQTERVLANCRIRPVVNQV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 27/135 (20%)
CG9436NP_610235.1 ARA1 3..298 CDD:223729 46/222 (21%)
Tas 6..282 CDD:223739 46/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.