DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and zgc:56622

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_005169977.1 Gene:zgc:56622 / 326033 ZFINID:ZDB-GENE-030131-4758 Length:324 Species:Danio rerio


Alignment Length:223 Identity:42/223 - (18%)
Similarity:95/223 - (42%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 STGNIIATELGQRKSNEELYDGLKITLHTDSTAERVVVEKEIDELHGRVQRATQELTTRLTENGR 79
            |||    .::.||.....:..|.:   |.|:.   .....|:| :...:|...|:...|     |
Zfish    31 STG----PDMCQRACEAAIAAGYR---HIDTA---FCYRNEVD-VGMAIQNKIQQGIIR-----R 79

  Fly    80 NEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATTKPPCSEDSN 144
            .::.|.:|::...|:.|.:.....:.|..|.:.::|..::.:         ||...|  ..::. 
Zfish    80 QDMFIVSKLWGTHHAPEDIPVCFNKSLSDLQLDYLDQYLVHF---------PVGLKK--VGDEL- 132

  Fly   145 VSRATNWSQRNGKEGVAELK--ELYKTLEQYALKQQITQLGIADLDAAALEELHNSAQVVPTIAQ 207
                  :.:|:||....::.  ::::.:|......::..:|:::.....::.|.:.|::.|.:.|
Zfish   133 ------FPERDGKILTTDIDYVDVWRGMEALKATGKVKSIGVSNFTMEQIDRLLSVAKIPPAVNQ 191

  Fly   208 VNLSTCCVVPPELQEFCTAHDIQLNTHS 235
            |.|.. .:|..:|.::|.:.:|.|..||
Zfish   192 VELHP-YLVQSDLIDYCKSKNIALTAHS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 29/159 (18%)
zgc:56622XP_005169977.1 ARA1 10..308 CDD:223729 42/223 (19%)
Tas 22..300 CDD:223739 42/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.