DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1c19

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001094046.1 Gene:Akr1c19 / 307096 RGDID:1562954 Length:323 Species:Rattus norvegicus


Alignment Length:322 Identity:66/322 - (20%)
Similarity:114/322 - (35%) Gaps:100/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ITKKYQNVVISTGNII-ATELGQRKSNEELYDGLKITLHTDSTAERVVVEKEIDELHGRVQRATQ 68
            ::.|.|.|.::.|:.| |...|..|                  .|.|...|.::.:|..|:...:
  Rat     1 MSSKQQLVKLNDGHFIPALGFGTYK------------------PEEVPENKPLEAIHLAVEAGFR 47

  Fly    69 ELTTRL---TEN---------------GRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVD 115
            .:.|..   |||               .|.:|.|..|::...|..|.|..::|:.|..|.:.:||
  Rat    48 HIDTAYVYQTENHVGQAIKSKIAAGIVKREDIFITTKLWCTFHRPEMVLSSLEKSLKNLQLDYVD 112

  Fly   116 NVVLAYHPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKE--GVAELKELYKTLEQYALKQQ 178
            ..::.| |..:.:...:      ..||           .|||.  ...:|...::.:|:......
  Rat   113 LYIIHY-PMQMKSGEDM------FPED-----------ENGKTLFDTVDLCATWEAMEKCKDAGL 159

  Fly   179 ITQLGIADLDAAALEELHN--SAQVVPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTH---- 234
            ...:|:::.:...||::.|  ..:..|...||.    |   :...:|..:|.:.||.|..:    
  Rat   160 AKSIGVSNFNRRQLEKILNKPGLKYKPVCNQVE----CHLYLNQSKLLNYCKSRDIVLVAYCALG 220

  Fly   235 ----------SDPELLL-PV--------EQFDGLVPGYTIDWTLRYQVHVRCRG-VLTAKGY 276
                      |.|.||. ||        ::....:       .||||:.   || |:.|:.|
  Rat   221 SQRPKRWVDPSSPVLLNDPVLCDVAKKHQRSSAQI-------ALRYQLQ---RGNVVLAQSY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 35/179 (20%)
Akr1c19NP_001094046.1 AKR_AKR1C1-35 6..308 CDD:381334 65/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.