DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1e2

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001008343.1 Gene:Akr1e2 / 307091 RGDID:1309599 Length:301 Species:Rattus norvegicus


Alignment Length:273 Identity:48/273 - (17%)
Similarity:101/273 - (36%) Gaps:75/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LGQRKSNE-ELYDGLKITL-------------HTDSTAERVVVEKEIDELHGRVQRATQELTTRL 74
            ||..|::. |:.|.:|:.:             |.:|.....:.|| |.|  |.|:          
  Rat     9 LGTWKASPGEVTDAVKVAINLGYRHFDCAYLYHNESEVGMGIKEK-IKE--GVVK---------- 60

  Fly    75 TENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATTKPPC 139
                |:|:.|.:|::...|....|..|....|..|::.::| :.|.:.|...         ||  
  Rat    61 ----RDELFIVSKLWCTYHKQSLVKTACINTLEALNLDYLD-LYLIHWPMGF---------KP-- 109

  Fly   140 SEDSNVSRATNWSQRNGK--EGVAELKELYKTLEQYALKQQITQLGIADLDAAALEELHN--SAQ 200
             .|.::.     ..|:||  .......:.::.:|...::..:..:|:::.:...|:.|.|  ..:
  Rat   110 -GDKDIP-----LDRSGKVIPSHTSFLDTWEAMEDLVIEGLVKNIGVSNFNHEQLDRLLNKPGLR 168

  Fly   201 VVPTIAQVNLSTCC---VVPPELQEFCTAHDIQLNTH------------SDPELLLPVEQFDGLV 250
            :.|...|:.    |   :....|.:||...::.:..:            .|..::..:.:..|..
  Rat   169 IKPITNQIE----CHPYLNQKSLIDFCHGRNVSVTAYRPLGGSRDGVHLMDDIVIRKIAKKHGKS 229

  Fly   251 PGYTIDWTLRYQV 263
            |...:   :|:|:
  Rat   230 PAQIL---IRFQI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 30/177 (17%)
Akr1e2NP_001008343.1 Tas 4..287 CDD:223739 48/273 (18%)
ARA1 4..282 CDD:223729 48/273 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.