DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and GCLM

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_016856545.1 Gene:GCLM / 2730 HGNCID:4312 Length:275 Species:Homo sapiens


Alignment Length:231 Identity:68/231 - (29%)
Similarity:115/231 - (49%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ISTGNIIATELGQRK----SNEELYDGLKITLHTDSTAERVVVEKEI-DELHGRVQRATQELTTR 73
            :.|||::.....::|    .:|||:|.::.||:..|:.....:.:|. |.|...|..|.:    :
Human    20 LQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE----K 80

  Fly    74 LTENGRNEISIGAKIFL-NRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATTKP 137
            :..:.|.|:.:.||:|: ..:|:.|...||:....:|.|..:|:|::|               .|
Human    81 INPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVAQLDSVIIA---------------SP 130

  Fly   138 PCSEDSNVSRATNWSQRNGKEGVAELKELYKTLEQYALKQQITQLGIADLDAAALEELHNSAQVV 202
            |..:..|:|             :..|:..::.||.....::|..:|.:|||...||:|:..|||.
Human   131 PIEDGVNLS-------------LEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVK 182

  Fly   203 PTIAQVNLSTCCVVPPELQEFCTAHDIQLNTHSDPE 238
            |...||||::|||:||:|..|....||||.||:||:
Human   183 PNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 51/159 (32%)
GCLMXP_016856545.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158929
Domainoid 1 1.000 78 1.000 Domainoid score I8810
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1557
Inparanoid 1 1.050 118 1.000 Inparanoid score I4802
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48881
OrthoDB 1 1.010 - - D1516283at2759
OrthoFinder 1 1.000 - - FOG0006260
OrthoInspector 1 1.000 - - oto90991
orthoMCL 1 0.900 - - OOG6_106072
Panther 1 1.100 - - LDO PTHR13295
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4224
SonicParanoid 1 1.000 - - X5208
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.