DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and SPCC737.06c

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_588368.1 Gene:SPCC737.06c / 2539059 PomBaseID:SPCC737.06c Length:287 Species:Schizosaccharomyces pombe


Alignment Length:307 Identity:70/307 - (22%)
Similarity:126/307 - (41%) Gaps:60/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ITKKYQNVVISTGNIIAT------ELGQRKSNEEL---YDGLKITLHTDSTAERVVVEKEIDELH 60
            |..:.:::::.||::...      ...:.|||.||   .:.:|:|..|....|.  ::|.|..| 
pombe     2 IQNEKKHLILYTGDVTKNLKSGIWNASRIKSNLELVKALENVKLTKFTGDGDEN--LKKNIKVL- 63

  Fly    61 GRVQRATQELTTRLTENGRNEISIGAKIFL-------NRHSTESVNQAVEELLHILSVTHVDNVV 118
            ..|....|:|     :..:.|..|..|:|.       .:...|:::|....|..:..:..|..:|
pombe    64 VPVNEKPQKL-----DGKQEEYEIIVKLFFLDGENIDIKKREETLSQVFYNLHMLFGIDFVSTLV 123

  Fly   119 LAYHPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELK--------ELYKTLEQYAL 175
            :::         |..|.         :..:.|.|.....:.:.|:.        :.:|.||:...
pombe   124 VSF---------PHITF---------LKESGNSSSNEIYDSIDEIPPQEIQSWVDTWKLLEEKVG 170

  Fly   176 KQQITQLGIADLDAAALEELHNSAQVVPTIAQVNLSTCCVVPPELQEFCTAHDIQLNTHSDPELL 240
            :.:|..||:::.....|:.|.:|..|||...|:|:...|.:|.:|..|...|.::|..||||..|
pombe   171 EGKIGTLGVSEFGVNELQRLISSVNVVPESTQINIGQNCKLPNDLLNFADRHHLKLFFHSDPSAL 235

  Fly   241 LPVEQFDGLV---------PGYTIDWTLRYQVHVRCRGVLTAKGYIV 278
            |...:...::         |. .:||.:||.:..|...|:..|||||
pombe   236 LSESEITSVIHKACPEIPNPA-RVDWVIRYTILTRHTAVIHQKGYIV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 37/173 (21%)
SPCC737.06cNP_588368.1 ARA1 4..283 CDD:223729 69/305 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006260
OrthoInspector 1 1.000 - - oto101779
orthoMCL 1 0.900 - - OOG6_106072
Panther 1 1.100 - - LDO PTHR13295
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4224
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.