DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1d1

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_620239.2 Gene:Akr1d1 / 192242 RGDID:620752 Length:325 Species:Rattus norvegicus


Alignment Length:207 Identity:48/207 - (23%)
Similarity:78/207 - (37%) Gaps:46/207 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VVVEKEIDE----LHGR-VQRATQELTTRLTEN------GRNEISIGAKIFLNRHSTESVNQAVE 103
            :.|:..|||    :.|. |.|...|:...:.|.      .|.||....|::...|..|.|..|:|
  Rat    38 IAVKTAIDEGYRHIDGAYVYRNEHEVGEAIREKVAEGKVKREEIFYCGKLWSTDHDPEMVRPALE 102

  Fly   104 ELLHILSVTHVDNVVLAYHPNAVATATPVATTKP-----PCSEDSNVSRATNWSQRNGKEGVAEL 163
            ..|..|.:.::|..::         ..|:| .||     |..|:..|.    :.:.|       |
  Rat   103 RTLQTLKLDYIDLYII---------EMPMA-FKPGEEFYPKDENGRVI----YHKSN-------L 146

  Fly   164 KELYKTLEQYALKQQITQLGIADLDAAALEELHN--SAQVVPTIAQVNLSTCC---VVPPELQEF 223
            ...::.||.......:..||:::.:...||.:.|  ..:..|...||.    |   ....:|.:|
  Rat   147 CATWEALEACKDAGLVKSLGVSNFNRRQLEVILNKPGLKYKPVTNQVE----CHPYFTQTKLLKF 207

  Fly   224 CTAHDIQLNTHS 235
            |..|||.:..:|
  Rat   208 CQQHDIVIVAYS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 39/167 (23%)
Akr1d1NP_620239.2 AKR_AKR1D1-3 15..321 CDD:381335 48/207 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.