DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and ZK1290.5

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_495578.2 Gene:ZK1290.5 / 191555 WormBaseID:WBGene00022887 Length:321 Species:Caenorhabditis elegans


Alignment Length:283 Identity:52/283 - (18%)
Similarity:90/283 - (31%) Gaps:94/283 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIPTITKKYQNVVISTGNIIATELGQRKSNEELYDGLKITLHTDSTAERVVVEKE--IDELHGRV 63
            |||| |....||.:....:..|..|....:..|:...|.......||:|..|||:  |...:..|
 Worm     1 MIPT-TVLSNNVEMPLIGLGTTHSGGYYHDAVLHSIKKCGYRLIDTAKRYGVEKQLGIAVKNCSV 64

  Fly    64 QRATQELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVAT 128
            .|....|:|:|.     .:..|.:::          .|.:.....|...::|..::         
 Worm    65 PREEMFLSTKLW-----PVDCGDEVY----------NAFQTSCEKLQTDYLDMYMI--------- 105

  Fly   129 ATPVATTKPPCSEDSNVSRATNW--SQRNGKEGVAELKELYKTLEQYAL---KQQITQLGIADLD 188
                           ::.:..:|  :|:..||         ||..|..|   .:.:..:|:::..
 Worm   106 ---------------HMPQLPDWIVNQKETKE---------KTWRQMELLYEDEHVRSIGVSNYS 146

  Fly   189 AAALEELHNSAQVVPTIAQVNL----------------------------------STCCVVPPE 219
            ...|:||...|.::|...||.|                                  .|.|.:..:
 Worm   147 IEDLDELLEFASILPHANQVELHPWFHQADLKNYCDELGILTMGYCPLAKGKYLEDETLCKIASK 211

  Fly   220 LQ----EFCTAHDIQLNTHSDPE 238
            .|    :.|....||.|..:.|:
 Worm   212 YQKSPAQICLRWSIQQNVPTVPK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 28/201 (14%)
ZK1290.5NP_495578.2 ARA1 1..268 CDD:223729 52/283 (18%)
Tas 16..261 CDD:223739 45/267 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.