DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and C01G5.5

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_500993.1 Gene:C01G5.5 / 182074 WormBaseID:WBGene00015307 Length:287 Species:Caenorhabditis elegans


Alignment Length:210 Identity:41/210 - (19%)
Similarity:85/210 - (40%) Gaps:50/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DGLKITLHTDSTAERVVVEKEIDELHGRVQRATQELTTRLTENG--RNEISIGAKIF--LNRHST 95
            :.||:...:..||:....||::.          ..|.|.|..:.  ..:|.:.:|:|  .::::.
 Worm    31 EALKVGYRSFDTAKYYENEKDLG----------LALKTLLPRHNICSEDIYLTSKVFPYSSKNAA 85

  Fly    96 ESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGV 160
            |.:.:.|.|.|.:|...::| :||.::|            :|..:||.|         .|.|   
 Worm    86 ELIRKDVNESLELLDRKYLD-LVLVHYP------------RPLDTEDLN---------ENNK--- 125

  Fly   161 AELKELYKTLEQYALKQQITQLGIADLDAAALEELHNSAQVVPTIAQVNLSTCCVVPPELQE--- 222
            ...|:.:..||:...:.:|..:|:::.:...:||:.:...:.|.:.|:...      |..|.   
 Worm   126 MYRKDTWIALEKLHAEGKIRSIGVSNYEPHHIEEMRSYITIEPQVNQIEYH------PHFQRKVL 184

  Fly   223 --FCTAHDIQLNTHS 235
              :|..::|.....|
 Worm   185 RAYCNKNEILFQAFS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 32/164 (20%)
C01G5.5NP_500993.1 AKR_AKR1-5-like 10..270 CDD:381297 41/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.