DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and F53F1.2

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001379192.1 Gene:F53F1.2 / 179821 WormBaseID:WBGene00009980 Length:297 Species:Caenorhabditis elegans


Alignment Length:244 Identity:54/244 - (22%)
Similarity:104/244 - (42%) Gaps:52/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TAERVVVEKEIDELHGRVQRATQELTTRLTENG--RNEISIGAKIF-LNRHSTESVNQAVEELLH 107
            ||:..:.|||:.|          .|...|.::|  |:::.:.:|.| .:::..|:....|||.|.
 Worm    53 TAKYYLNEKELGE----------ALKILLPKHGLSRSDVFLTSKFFPESKNCREACRGFVEESLQ 107

  Fly   108 ILSVTHVDNVVLAYHPNAVATATPVATTKPPCSEDSNVSRATNWSQRNGKEGVAELKEL-YKTLE 171
            .|...::| :.|.::|            ||..|::.:|:.             ||.::: |:.||
 Worm   108 SLQTDYID-MYLVHYP------------KPNDSDNDDVNN-------------AEYRKIAYEVLE 146

  Fly   172 QYALKQQITQLGIADLDAAALEELHNSAQVVPTIAQVNLSTCCVVPPELQEFCTAHDIQLNTHS- 235
            :.....::..:|:::.:...||||...|:|.|...|:.........| ||::|...:|.....| 
 Worm   147 EAKAAGKVRSIGVSNYEIVHLEELKTYAKVPPCANQLEYHPHFARIP-LQKYCKEKNIFFQAFSS 210

  Fly   236 ----------DPELLLPVEQFDGLVPGYTIDWTLRYQVHVRCRGVLTAK 274
                      ||.::...::.:..||...:.|.||..|.:..:.|..::
 Worm   211 LARHEPKLIEDPVVVELAKKHNTSVPLVLLAWALRQNVGIVPKSVTPSR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 37/171 (22%)
F53F1.2NP_001379192.1 AKR_AKR1-5-like 21..279 CDD:381297 54/244 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.