DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and ZC443.1

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_506205.1 Gene:ZC443.1 / 179756 WormBaseID:WBGene00013896 Length:320 Species:Caenorhabditis elegans


Alignment Length:160 Identity:34/160 - (21%)
Similarity:74/160 - (46%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATTKPPCSEDS 143
            |.:|.|..|.|.:..:.:.|.:|:...|..|.:.:|| :.||:.|         |:||...|..|
 Worm    73 REDIFITTKAFCHEVAPDVVEEALRNSLKRLRLDYVD-LYLAHIP---------ASTKDDGSFRS 127

  Fly   144 NVSRATNWSQRNGKEGVAELKELYKTLEQ-YALKQQITQ-LGIADLDAAALEELHNSAQVVPTIA 206
            :|                :::::::..|: |.|  .:|: :|:::.:.:.:..:.|..:|....:
 Worm   128 DV----------------KVEDIWRGFEKVYGL--GLTKAIGVSNFNESQIVRIMNIQKVPIHAS 174

  Fly   207 QVNLSTCCVVPPEL-QEFCTAHDIQLNTHS 235
            |:.|.  ..:|.:. :|.|..|:|.:..::
 Worm   175 QLELH--LYLPQKAHRELCKKHNILITAYA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 34/160 (21%)
ZC443.1NP_506205.1 AKR_AKR1G1_CeAKR 5..303 CDD:381380 34/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.