DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and exc-15

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001367925.1 Gene:exc-15 / 178844 WormBaseID:WBGene00020369 Length:333 Species:Caenorhabditis elegans


Alignment Length:154 Identity:34/154 - (22%)
Similarity:67/154 - (43%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHP----NAVATATPVATTKPPC 139
            |.:|.:.:|:....|:.|.|.:.||..|..|.:.::| :.|.:.|    :...:..|:       
 Worm    72 REDIFVTSKLPFTAHAPEDVPKCVESQLKALQLEYID-LYLIHCPFPFKHQEGSFAPL------- 128

  Fly   140 SEDSNVSRATNWSQRNGKEGVAELKEL--YKTLEQYALKQQITQLGIADLDAAALEELHNSAQVV 202
                         ..||:..|.|:..:  ::.||:...:.::..||:::.....|:.|:::|:|.
 Worm   129 -------------MENGELAVTEIAHIDTWRALEKLYKEGKLKALGVSNFSCNQLQALYDAAEVK 180

  Fly   203 PTIAQVNLSTCCVVPP--ELQEFC 224
            |...||.   |.:..|  ||:..|
 Worm   181 PANQQVE---CHIYWPQQELRALC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 34/154 (22%)
exc-15NP_001367925.1 AKR_AKR1G1_CeAKR 3..306 CDD:381380 34/154 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.