DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Y39G8B.2

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_496926.1 Gene:Y39G8B.2 / 175048 WormBaseID:WBGene00012723 Length:339 Species:Caenorhabditis elegans


Alignment Length:284 Identity:59/284 - (20%)
Similarity:115/284 - (40%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TITKKYQNVVISTGNIIATELGQRKSNEELYDGLKITL-HTDSTAERVVVEKEIDELHGRVQRAT 67
            |:...|:..||..|   ..:|.:..:.|.:.|.|:... |.||    .:..|..:|:...::.  
 Worm     8 TLNSGYEMPVIGYG---TWQLPKNLAAERVRDALEAGYRHIDS----ALSFKNQEEVAAGIKD-- 63

  Fly    68 QELTTRLTENGRNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPV 132
               ..::.:..|.|:.:.:||:...||.....|.::|:|.|...|::|.:|:.:         |.
 Worm    64 ---WCKIRKVRREELFLSSKIWNTYHSRNRCMQQIDEMLEIFETTYMDLIVIHW---------PF 116

  Fly   133 ATTKPPCSEDSNVSRATNWSQ-RNGKEGVAELK--ELYKTLEQYALKQQITQLGIADLDAAALEE 194
            .     .:||........|.: .|||...:::.  |.:|.||......:|..:|:|:.:...:|:
 Worm   117 G-----WAEDEPPGERGLWPRGANGKMRYSDVDYLETWKALEDAHRSGKIRSIGLANFNIGQVEQ 176

  Fly   195 LHNSAQVVPTIAQVNLSTCCVVPPELQEFCTAHDIQLNT--------------HSDPELLLPVEQ 245
            :.....:.|.:.||.::. .:...|:::||....|.|..              |.||.||.. |.
 Worm   177 VWTKGLIKPAVLQVEMNP-FLDQEEIRQFCREKGIILTAFMLTGNPGSALYRKHEDPNLLYN-ET 239

  Fly   246 FDGLVPGY---TIDWTLRYQVHVR 266
            ...:..|:   .:...:|:.:.:|
 Worm   240 LQSIAKGHGKSVVQVLVRWAIDLR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 38/175 (22%)
Y39G8B.2NP_496926.1 AKR_AKR1-5-like 15..295 CDD:381297 57/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.