DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and AKR1C1

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001344.2 Gene:AKR1C1 / 1645 HGNCID:384 Length:323 Species:Homo sapiens


Alignment Length:323 Identity:72/323 - (22%)
Similarity:118/323 - (36%) Gaps:108/323 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KYQNV---------VISTGNIIATELGQRKSNEELYDGLKITLHTDSTAERVVVE---KEIDELH 60
            |||.|         |:..|.....|:.:.|:.|               |.::.:|   :.||..|
Human     4 KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALE---------------ATKLAIEAGFRHIDSAH 53

  Fly    61 --GRVQRATQELTTRLTENG--RNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAY 121
              ...::....:.:::.:..  |.:|...:|::.|.|..|.|..|:|..|..|.:.:|| :.|.:
Human    54 LYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVD-LYLIH 117

  Fly   122 HPNAVATATPVATTKPPCSED-----SNVSRATNWSQRNGKEGVAELKE--LYKTLEQYALKQQI 179
            .|.:|.....|.    |..|:     ..|.....|      |.|.:.|:  |.|:          
Human   118 FPVSVKPGEEVI----PKDENGKILFDTVDLCATW------EAVEKCKDAGLAKS---------- 162

  Fly   180 TQLGIADLDAAALEELHN--SAQVVPTIAQVNLSTCCVVPP-----ELQEFCTAHDIQLNTHS-- 235
              :|:::.:...||.:.|  ..:..|...||...      |     :|.:||.:.||.|..:|  
Human   163 --IGVSNFNRRQLEMILNKPGLKYKPVCNQVECH------PYFNQRKLLDFCKSKDIVLVAYSAL 219

  Fly   236 ---------DPE--LLL--PV--------EQFDGLVPGYTIDWTLRYQVHVRCRGVLT-AKGY 276
                     ||.  :||  ||        ::...|:       .||||:.   |||:. ||.|
Human   220 GSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALI-------ALRYQLQ---RGVVVLAKSY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 42/183 (23%)
AKR1C1NP_001344.2 AKR_AKR1C1-35 6..308 CDD:381334 70/321 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.