DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and Akr1c20

DIOPT Version :10

Sequence 1:NP_732780.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001298061.1 Gene:Akr1c20 / 116852 MGIID:2151104 Length:323 Species:Mus musculus


Alignment Length:36 Identity:11/36 - (30%)
Similarity:16/36 - (44%) Gaps:5/36 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PVYENQ----NPNYNYLFR-PSITATKYGGKPAAGT 143
            |:|:.|    ..|.|.:.| ..:|....|..||.|:
Mouse    25 PIYQPQVGLIASNSNEILRLNGLTLAGMGLGPAQGS 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_732780.1 AKR_SF <79..>235 CDD:444925 11/36 (31%)
Akr1c20NP_001298061.1 AKR_AKR1C1-35 6..306 CDD:381334 11/36 (31%)

Return to query results.
Submit another query.