DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclm and AKR1A1

DIOPT Version :9

Sequence 1:NP_001262845.1 Gene:Gclm / 248194 FlyBaseID:FBgn0046114 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001189342.1 Gene:AKR1A1 / 10327 HGNCID:380 Length:325 Species:Homo sapiens


Alignment Length:210 Identity:44/210 - (20%)
Similarity:84/210 - (40%) Gaps:52/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RNEISIGAKIFLNRHSTESVNQAVEELLHILSVTHVDNVVLAYHPNAVATATPVATTKPPCSEDS 143
            |.|:.:.:|::..:|..|.|..|:.:.|..|.:.::| :.|.:.|.|                  
Human    72 REELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLD-LYLMHWPYA------------------ 117

  Fly   144 NVSRATNWSQRNGKEGV----AELKELYKTLEQYALKQQITQLGIADLDAAALEELHNSAQVVPT 204
             ..|..|...:|....:    ...||.:|.||....|..:..||:::.::..::::.:.|.|.|.
Human   118 -FERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPA 181

  Fly   205 IAQVNLSTCC---VVPPELQEFCTAHDIQLNTHS----------DPE--------LLLPVEQFDG 248
            :.||.    |   :...||...|.|..:::..:|          ||:        ::|.:.:..|
Human   182 VLQVE----CHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYG 242

  Fly   249 LVPGYTIDWTLRYQV 263
            ..|...:   ||:||
Human   243 RSPAQIL---LRWQV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclmNP_001262845.1 Aldo_ket_red <79..>238 CDD:294321 36/175 (21%)
AKR1A1NP_001189342.1 ARA1 6..303 CDD:223729 44/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.