DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gos28 and GOSR1

DIOPT Version :9

Sequence 1:NP_650739.2 Gene:Gos28 / 248102 FlyBaseID:FBgn0044871 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_005258127.1 Gene:GOSR1 / 9527 HGNCID:4430 Length:300 Species:Homo sapiens


Alignment Length:240 Identity:112/240 - (46%)
Similarity:157/240 - (65%) Gaps:17/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LRKQARSLENEIDLKLVAFSKI----GAGSGGGGSGGLGGVDTSPLLG----EHVFDSLSEEIEQ 65
            ||||||.||||:|||||:|||:    ...|...|.......||:|||.    :.:|::::.||||
Human    62 LRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQ 126

  Fly    66 MLEKLSSLNESMSD------LPASGAAAMHTLQRHREILQGYRQEFNKICANHTMRIEREELLRG 124
            :|.:|:.:|:.|::      :|:..||.||||||||:|||.|..||:|..||. |.|...|.|.|
Human   127 LLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANF-MAIRERENLMG 190

  Fly   125 SGLATSSGSPSISGLNRR--EMYLKESGHLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTRF 187
            |.........|.||:|.|  |::|||..||.::..|:.:.|:||:.|::::.:||...|.:.::.
Human   191 SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKM 255

  Fly   188 NDISNRFPLISSLIQRINIKKRRDSLILGAVIGFCVILLLLYAFN 232
            |.::||||.::|||||||::|||||||||.|||.|.||||||||:
Human   256 NTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gos28NP_650739.2 SNARE 142..207 CDD:419871 27/66 (41%)
GOSR1XP_005258127.1 SNARE_GS28 210..275 CDD:277217 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143149
Domainoid 1 1.000 101 1.000 Domainoid score I6979
eggNOG 1 0.900 - - E1_KOG3208
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37977
Inparanoid 1 1.050 196 1.000 Inparanoid score I3821
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55290
OrthoDB 1 1.010 - - D1319902at2759
OrthoFinder 1 1.000 - - FOG0004151
OrthoInspector 1 1.000 - - oto89790
orthoMCL 1 0.900 - - OOG6_102989
Panther 1 1.100 - - LDO PTHR21094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R505
SonicParanoid 1 1.000 - - X5179
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.