DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gos28 and GOS1

DIOPT Version :9

Sequence 1:NP_650739.2 Gene:Gos28 / 248102 FlyBaseID:FBgn0044871 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_011832.1 Gene:GOS1 / 856354 SGDID:S000001023 Length:223 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:50/227 - (22%)
Similarity:103/227 - (45%) Gaps:18/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPLLGEHVFDSLSEEIEQMLEK 69
            |:..:|.:|.|||.:.:..|..:|.....:....:|....:|          ..|...:.|..:.
Yeast     6 SFVTIRGKAISLETQTESLLSKYSTFAQTTSSEQTGQEKKID----------KQLEGILGQRQDV 60

  Fly    70 LSSLNESMSDLPASGAAAMHTLQRHREILQGYRQEFNKICANHTMRIEREEL-----LRGSGLAT 129
            :.||.:.....||..|:.:..|.||:||||.:.:.|..|  ..:::.||..|     ::.....:
Yeast    61 IDSLTQICDSNPAISASKLSQLHRHKEILQDHWKSFRNI--RSSIQQERNRLNLLFSVKNDIANS 123

  Fly   130 SSGSPSISGLNRREMYLKESGHLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTRFNDISNRF 194
            ::.:|:..| :..|....|:..::.::::|:..|:.|.|||...|:|.........:......|.
Yeast   124 TTDAPAPIG-DADEYIQNETRRIDQSNNVVDRLISQAWETRSQFHSQSNVLNTANNKVLQTLQRI 187

  Fly   195 PLISSLIQRINIKKRRDSLILGAVIGFCVILL 226
            |.::.||.:||.::::::.:|..:...|::.|
Yeast   188 PGVNQLIMKINTRRKKNAFVLATITTLCILFL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gos28NP_650739.2 SNARE 142..207 CDD:419871 16/64 (25%)
GOS1NP_011832.1 V-SNARE_C 136..201 CDD:289148 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3208
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37977
Inparanoid 1 1.050 66 1.000 Inparanoid score I1733
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55290
OrthoFinder 1 1.000 - - FOG0004151
OrthoInspector 1 1.000 - - oto99541
orthoMCL 1 0.900 - - OOG6_102989
Panther 1 1.100 - - LDO PTHR21094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R505
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.