DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gos28 and GOS11

DIOPT Version :9

Sequence 1:NP_650739.2 Gene:Gos28 / 248102 FlyBaseID:FBgn0044871 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_563985.1 Gene:GOS11 / 838158 AraportID:AT1G15880 Length:223 Species:Arabidopsis thaliana


Alignment Length:229 Identity:62/229 - (27%)
Similarity:109/229 - (47%) Gaps:17/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPLLGEHVFDS-LSEEIEQML 67
            ||:|.||||||.:|.::|.::.::.::              |.|..|......:| |...|:.:|
plant     5 SSWDALRKQARKIEAQLDEQMHSYRRL--------------VSTKALSKSDGNESDLEAGIDLLL 55

  Fly    68 EKLSSLNESMSDLPASGAAAM--HTLQRHREILQGYRQEFNKICANHTMRIEREELLRGSGLATS 130
            .:|..:|..|....:||.:.|  |||.||:||||...|||.:..::...:.|...||........
plant    56 RQLQQVNAQMQAWVSSGGSEMVSHTLTRHQEILQDLTQEFYRHRSSLRAKQEHASLLEDFREFDR 120

  Fly   131 SGSPSISGLNRREMYLKESGHLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTRFNDISNRFP 195
            :......|....:..:||...:|..:..::..|:.|..|...|..||..|..:.::.:::::|.|
plant   121 TRLDLEDGYGSEQALIKEHMGINRNTAQMDGVISQAQATLGTLVFQRSTFGGINSKLSNVASRLP 185

  Fly   196 LISSLIQRINIKKRRDSLILGAVIGFCVILLLLY 229
            .:::::..|..||..|::||..|...|..|:.:|
plant   186 TVNTILAAIKRKKSMDTIILSLVAAVCTFLIFIY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gos28NP_650739.2 SNARE 142..207 CDD:419871 13/64 (20%)
GOS11NP_563985.1 V-SNARE_C 133..198 CDD:289148 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55290
OrthoDB 1 1.010 - - D1319902at2759
OrthoFinder 1 1.000 - - FOG0004151
OrthoInspector 1 1.000 - - otm2838
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21094
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.