DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gos28 and Gosr1

DIOPT Version :9

Sequence 1:NP_650739.2 Gene:Gos28 / 248102 FlyBaseID:FBgn0044871 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_058090.2 Gene:Gosr1 / 53334 MGIID:1858260 Length:250 Species:Mus musculus


Alignment Length:249 Identity:118/249 - (47%)
Similarity:167/249 - (67%) Gaps:20/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GGSSY-DVLRKQARSLENEIDLKLVAFSKI-----GAGSGGGGSGGLGGVDTSPLLG----EHVF 56
            |.|:| :.||||||.||||:|||||:|||:     .:||..||...... ||:|||.    :.:|
Mouse     4 GTSNYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSGSRDGGRDRYSS-DTTPLLNGSSQDRMF 67

  Fly    57 DSLSEEIEQMLEKLSSLNESMSD------LPASGAAAMHTLQRHREILQGYRQEFNKICANHTMR 115
            ::::.||||:|.:|:.:|:.|::      :|:..||.||||||||:|||.|..||:|..||.|..
Mouse    68 ETMAIEIEQLLARLTGVNDKMAEYTHSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFTAI 132

  Fly   116 IEREELLRGSGLATSSGSPSISGLNRR--EMYLKESGHLNSASHLVNDQINIAIETRDHLHAQRQ 178
            .|||.|: ||.........|.||:|.|  |::|||..||.::..|:.:.|:||:.|::::.:||.
Mouse   133 RERENLM-GSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRG 196

  Fly   179 AFKRLQTRFNDISNRFPLISSLIQRINIKKRRDSLILGAVIGFCVILLLLYAFN 232
            ..|.:.::.|.::||||.::|||||||::|||||||||.|||.|.||||||||:
Mouse   197 MLKSIHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gos28NP_650739.2 SNARE 142..207 CDD:419871 27/66 (41%)
Gosr1NP_058090.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..59 8/22 (36%)
SNARE_GS28 160..225 CDD:277217 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833315
Domainoid 1 1.000 106 1.000 Domainoid score I6603
eggNOG 1 0.900 - - E1_KOG3208
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37977
Inparanoid 1 1.050 200 1.000 Inparanoid score I3776
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55290
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004151
OrthoInspector 1 1.000 - - oto93362
orthoMCL 1 0.900 - - OOG6_102989
Panther 1 1.100 - - LDO PTHR21094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R505
SonicParanoid 1 1.000 - - X5179
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.