DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gos28 and gos-28

DIOPT Version :9

Sequence 1:NP_650739.2 Gene:Gos28 / 248102 FlyBaseID:FBgn0044871 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_498621.1 Gene:gos-28 / 176044 WormBaseID:WBGene00017273 Length:234 Species:Caenorhabditis elegans


Alignment Length:241 Identity:83/241 - (34%)
Similarity:144/241 - (59%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPLLGEHV-FDSLSEEIEQMLE 68
            :::.|||:|||.||.||:|||:.:|:.|.|.||..     :|...:..... |.:::.|||.::|
 Worm     4 TWEALRKKARSTENSIDVKLVSLNKLTASSHGGFD-----IDEKTVSSRQTSFKTVTTEIEGLIE 63

  Fly    69 KLSSLNESMSDLP--------ASGAAAMHTLQRHREILQGYRQEFNKICANHTMRIEREELLRGS 125
            :|:::|:.|:|:.        |:..|..|||:||||||:.|..|:.:...|....::||.||..|
 Worm    64 QLTNINDDMNDVAGAQSSASWANNPAIQHTLRRHREILRDYGSEYRRARDNVDQVLQRELLLSSS 128

  Fly   126 GLATSSGSPSISGLNRR----EMYLKESGHLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTR 186
            .  .:..:|.   ||.|    :|||||:.|:|:...|:::|:.:|:.|::::..|....:.:.||
 Worm   129 N--ENRNNPI---LNNRARGYDMYLKENDHINACDRLLDEQLEMAMSTKENMARQGINLRGISTR 188

  Fly   187 FNDISNRFPLISSLIQRINIKKRRDSLILGAVIGFCVILLLLYAFN 232
            .:.||.::|.|::|:|:|..||::::|||.|||..|:|..:.:..|
 Worm   189 LHHISKKYPAINNLMQKIKTKKQKNTLILAAVISSCLIFTIFWIIN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gos28NP_650739.2 SNARE 142..207 CDD:419871 22/68 (32%)
gos-28NP_498621.1 SNARE 145..206 CDD:304603 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157490
Domainoid 1 1.000 78 1.000 Domainoid score I5718
eggNOG 1 0.900 - - E1_KOG3208
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37977
Inparanoid 1 1.050 142 1.000 Inparanoid score I3062
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55290
OrthoDB 1 1.010 - - D1319902at2759
OrthoFinder 1 1.000 - - FOG0004151
OrthoInspector 1 1.000 - - oto20203
orthoMCL 1 0.900 - - OOG6_102989
Panther 1 1.100 - - LDO PTHR21094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R505
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.