DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina3c and Spn88Eb

DIOPT Version :9

Sequence 1:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:394 Identity:102/394 - (25%)
Similarity:182/394 - (46%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat    51 DFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGF 115
            ||:|:|.|::....|..|:.|||.|...||.:....:.:.|..|:.:.|..... :.::::...:
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA-LNKQQVLVSY 103

  Rat   116 GHLLQRLSQPEDQ-------AEINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQCNE-A 172
                 .|:|.:|:       .|:::.:.:|:|:...:.::|   ...||.|...: |||...| .
  Fly   104 -----TLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGATKEL-DFKNDPETG 159

  Rat   173 KKFINDYVSNQTQGKIAELFS--DLDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSV 235
            .|.|||:::::|..:|.::.|  ::...|.:||.|....||:|...|...:|....|:::|:...
  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224

  Rat   236 KVPMMKIKDLTTPYVRDEELSCSVLELKY----------------TGNASALFILPDQGK--MQQ 282
            .|.||. |........||.|...:::|.|                ..:.|.:.|||:..|  :.:
  Fly   225 MVYMMH-KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNR 288

  Rat   283 VESSLQPETLKKWKDSLRPRIISELRMPKFSISTDYNLEEVLPELGIRKIFSQQADLSRITGTK- 346
            |.|.|..:::|||.:...|:.| ||.:|||.......|..:|..:|:..:|::.|....:|... 
  Fly   289 VISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPI 352

  Rat   347 NLHVSQVVHKAVLDVDETGTEGAAATAVTAALKSLPQTVPLLNFNRPFMLVITDNNGQSVFFMGK 411
            :|.:....|.|.:.|||.|:..||||.:..:..|........|.|.||:.:|.|....::.|.|.
  Fly   353 SLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGV 417

  Rat   412 VTNP 415
            .::|
  Fly   418 YSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 99/389 (25%)
RCL 365..392 7/26 (27%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 101/389 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.