DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sparc and Fs

DIOPT Version :10

Sequence 1:NP_036788.1 Gene:Sparc / 24791 RGDID:3742 Length:301 Species:Rattus norvegicus
Sequence 2:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster


Alignment Length:91 Identity:27/91 - (29%)
Similarity:39/91 - (42%) Gaps:16/91 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat    67 ENPCQNHHCKHGKVCELDESNTPMCV-CQDPTSCP--------APIGEFEKVCSNDNKTFDSSCH 122
            :|.|...||.:|..|..|:...|.|: |:  ..||        :...|.:.||..|.||:.|:|.
  Fly   605 KNSCSGVHCLNGLTCVEDQYLMPHCIACR--IECPWDNLDVDSSGYDERQAVCGVDGKTYRSACD 667

  Rat   123 FFATKCTLEGTKKGHKLHLDYIGPCK 148
            .....|     |.|..:.:.|.|||:
  Fly   668 INRMIC-----KIGRSIAVAYPGPCR 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SparcNP_036788.1 FSL_SPARC 69..150 CDD:238649 26/89 (29%)
EFh_SPARC_SPARC 153..292 CDD:320014
EF-hand motif 225..258 CDD:320014
EF-hand motif 260..292 CDD:320014
FsNP_652376.2 KAZAL 564..604 CDD:197624
KAZAL_FS 654..687 CDD:238052 12/37 (32%)
KAZAL_FS 723..767 CDD:238052
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.