DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpn1 and CG42327

DIOPT Version :9

Sequence 1:XP_038960209.1 Gene:Ptpn1 / 24697 RGDID:61965 Length:451 Species:Rattus norvegicus
Sequence 2:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster


Alignment Length:315 Identity:92/315 - (29%)
Similarity:146/315 - (46%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat    41 DIRHEASDFPCRIAKL----PKNKNRNRYRDVSPFDHSRIKLHQEDND----YINASLIK-MEEA 96
            |:..|..|.|..||:.    |..:::|||.:|.|...:|:.|.::.:|    ||||:.:: ..:|
  Fly  1110 DVFEEFRDVPQIIARADEVPPGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPRDA 1174

  Rat    97 QRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLKCAQYWPQKEEKEMVFDDTNLKL 161
            ...||..|.||.:|...||.|:|||:||.::....:.|.|..:||:|.|.....:......:.::
  Fly  1175 PNYYIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEYLPPSATLDNHSSYGDYQV 1239

  Rat   162 TLISEDVKSYYTVRQLELENLATQEAREILHFHYTTWPDFGVPESPASFLNFLFKVR-------- 218
            ||...:||..|.:..|.|:.:..:|:||:.|:.| .||:.|||...|..:..|.:.|        
  Fly  1240 TLKHREVKDRYAISTLVLKRVDGEESRELTHYWY-KWPEAGVPAEEAPIIAMLLEARSSLKSYSL 1303

  Rat   219 ------------------------ESGSLS---------------PEHGPIVVHCSAGIGRSGTF 244
                                    |:||.|               .:.||:.||||.|.||:||.
  Fly  1304 EQANELREKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTI 1368

  Rat   245 CLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSY-LAVIEGAK 298
            ..:|..:..::..|  .||||.:::..:||.|...:||.:|..|.| :|.:..||
  Fly  1369 IASDMAIRSLETPK--RSVDIPQLVYYVRRGRASAVQTKEQYEFIYKVASMYAAK 1421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpn1XP_038960209.1 PTPc-N1 38..311 CDD:350456 92/315 (29%)
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 82/283 (29%)
Y_phosphatase 1134..1415 CDD:278528 82/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.