DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prss1 and alphaTry

DIOPT Version :9

Sequence 1:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:259 Identity:92/259 - (35%)
Similarity:139/259 - (53%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MSALLILALVGAAVAFPLED------DDKIVGGYTCPEHSVPYQVSL-NSGYHFCGGSLINDQWV 58
            :..:::|:.|..|:...:.:      |.:||||......|.|:|:|| .||.|.||||:.:...:
  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66

  Rat    59 VSAAHCYK----SRIQVRLGE---HNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSP 116
            |:||||.:    |.:|||.|.   .:..|:.....|.|      |..|::.|:.|||.:|:|||.
  Fly    67 VTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKN------HEGYNANTMVNDIAVIRLSSS 125

  Rat   117 VKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAA---YPGE 178
            :..::.:..::|.:.....|....:||||...|...:.|..||.|:..::||:.|.::   |..:
  Fly   126 LSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190

  Rat   179 ITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDT 242
            |.::|||..  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:..|
  Fly   191 IRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 86/226 (38%)
Tryp_SPc 24..242 CDD:238113 87/228 (38%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 86/226 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.