DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppp2ca and PpV

DIOPT Version :9

Sequence 1:NP_058735.1 Gene:Ppp2ca / 24672 RGDID:3380 Length:309 Species:Rattus norvegicus
Sequence 2:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster


Alignment Length:301 Identity:164/301 - (54%)
Similarity:214/301 - (71%) Gaps:0/301 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 ELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGG 73
            ::|:|||.:.:||.|.|:::|.|||...:||.:|:|:..|..|||||||:||||:||.:|||.||
  Fly     3 DVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGG 67

  Rat    74 KSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYG 138
            :.|.|||:||||:|||||||:||.|.|:.||.||..|||:||||||:||||:||||:|||..|||
  Fly    68 QVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYG 132

  Rat   139 NANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDP 203
            |||.|||...:||.|.:.|::|.::.|:||||||.|.|||.||.:||..|:|::|..|||:||||
  Fly   133 NANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDP 197

  Rat   204 DDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYR 268
            :|...||.||||||:.||.::::.|...|.|.|:.||||||.||..:..|..:||::||||||||
  Fly   198 EDMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYR 262

  Rat   269 CGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309
            |||.|||:..:...|.....|...|........:.|..|||
  Fly   263 CGNVAAILSFETAEKRQTKIFLAVPDAERVIPKQNTTPYFL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppp2caNP_058735.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 159/283 (56%)
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 162/299 (54%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 159/283 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.